PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_55.31
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MIKC_MADS
Protein Properties Length: 220aa    MW: 24952.3 Da    PI: 8.457
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_55.31genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.6e-29959151
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                 k+i+n++ rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl+eyss
  evm.model.supercontig_55.31  9 KKIDNTTARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEYSS 59
                                 68***********************************************96 PP

2K-box43.61.3e-15951722299
                        K-box  22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                                  ++L kei +  ++++++ Ge+L+ Ls+++LqqLe+ Le +l+++ +kK + ++++i++lq+k  +l een++Lr+++ 
  evm.model.supercontig_55.31  95 SRLCKEIAEKSHQLKQMRGEELQGLSIEQLQQLEKSLEVGLRRVIEKKGQNIMKEISDLQRKGLRLVEENEKLRQQIS 172
                                  67777788878899*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.628161IPR002100Transcription factor, MADS-box
CDDcd002656.93E-39270No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-28323IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-32374IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.52787177IPR002487Transcription factor, K-box
PfamPF014861.4E-1493171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAREKIQIKK IDNTTARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLFEYSSS  60
SMKEILERHR LHAKNLEKLE QPSLELQLVE NADRSRLCKE IAEKSHQLKQ MRGEELQGLS  120
IEQLQQLEKS LEVGLRRVIE KKGQNIMKEI SDLQRKGLRL VEENEKLRQQ ISNKGKQGGA  180
ESENVVYEEG QSSESVTNLC NSNGPPYDYE SSDTSLKLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-19169169Myocyte-specific enhancer factor 2B
1tqe_R1e-19169169Myocyte-specific enhancer factor 2B
1tqe_S1e-19169169Myocyte-specific enhancer factor 2B
3mu6_A8e-20372271Myocyte-specific enhancer factor 2A
3mu6_B8e-20372271Myocyte-specific enhancer factor 2A
3mu6_C8e-20372271Myocyte-specific enhancer factor 2A
3mu6_D8e-20372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0493790.0LC049379.1 Carica papaya mRNA for MADS-box protein, complete cds, cultivar: TM1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081656.11e-127PREDICTED: MADS-box protein SVP
RefseqXP_012081657.11e-127PREDICTED: MADS-box protein SVP
SwissprotQ9FVC11e-114SVP_ARATH; MADS-box protein SVP
TrEMBLA0A0F7QGF11e-136A0A0F7QGF1_CARPA; MADS-box protein
STRINGVIT_00s0313g00070.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Representative plantOGRP60761120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-116MIKC_MADS family protein